PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_64057.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 346aa    MW: 37987.8 Da    PI: 6.2358
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_64057.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.38.4e-55221491129
           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                   lppGfrFhPtdee++++yL++k+ ++++    vi evd++k+ePw+Lp k+k +ekewyfF+++d+ky+tg+r+nrat sgyWkatgkdke+++ +g
  MLOC_64057.2  22 LPPGFRFHPTDEEIISHYLTPKALDHRFCS-GVIGEVDLNKCEPWHLPGKAKMGEKEWYFFCHKDRKYPTGTRTNRATMSGYWKATGKDKEIFRGRG 117
                   79*************************888.89***************99999******************************************** PP

           NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                    lvg+kktLvfy grap+gekt Wvmhe+rle
  MLOC_64057.2 118 ILVGMKKTLVFYLGRAPRGEKTGWVMHEFRLE 149
                   *****************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019416.8E-6217172IPR003441NAC domain
PROSITE profilePS5100556.6522172IPR003441NAC domain
PfamPF023652.3E-2823148IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:1900057Biological Processpositive regulation of leaf senescence
GO:1903648Biological Processpositive regulation of chlorophyll catabolic process
GO:0000975Molecular Functionregulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MSEVSVINQA TEVEDAAAGL DLPPGFRFHP TDEEIISHYL TPKALDHRFC SGVIGEVDLN  60
KCEPWHLPGK AKMGEKEWYF FCHKDRKYPT GTRTNRATMS GYWKATGKDK EIFRGRGILV  120
GMKKTLVFYL GRAPRGEKTG WVMHEFRLEG RLPHPLPRSA KDEWAVSKVF NKELTATNGA  180
MATAMAAAPD AGIERVSSFG FISDHFLDAG ELPPLMDPPL GGDVDQVIDF NSNSAYATGG  240
RSGSGLEVKM EQHMPPHMMY SSPYFSLPAA NSGDLSPAIR RYCKAEQVSG QTSALSPSRD  300
TGLSTDPNAA GCAEISSAPT PSSHNQDFLD HLDEYPALNL ADIWKY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A3e-521517613172NAC domain-containing protein 19
3swm_B3e-521517613172NAC domain-containing protein 19
3swm_C3e-521517613172NAC domain-containing protein 19
3swm_D3e-521517613172NAC domain-containing protein 19
3swp_A3e-521517613172NAC domain-containing protein 19
3swp_B3e-521517613172NAC domain-containing protein 19
3swp_C3e-521517613172NAC domain-containing protein 19
3swp_D3e-521517613172NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00332DAPTransfer from AT3G04060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFR8197630.0FR819763.1 Hordeum vulgare subsp. vulgare mRNA for NAC transcription factor (NAC013 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003558001.10.0PREDICTED: NAC domain-containing protein 92-like
SwissprotQ9FLR37e-81NAC79_ARATH; NAC domain-containing protein 79
TrEMBLF6IAY20.0F6IAY2_HORVD; NAC transcription factor
STRINGMLOC_64057.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP186238104
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04060.12e-83NAC domain containing protein 46